Tap / click on image to see more RealViewsTM
£107.00
per throw blanket
 

Viking Pattern Blue Throw Blanket

Qty:

Other designs from this category

About Throw Blankets

Sold by

Size: Throw Blanket

This all-season throw blanket is designed for curling up with a cup of hot cocoa or relaxing on a summer evening with a cool glass of lemonade. Put a unique and stylish touch on your décor with your favourite patterns or designs or make one with your family photo memories for grandparents, mums, and dads!

  • Dimensions: 137.16 cm l x 96.52 cm w (54"l x 38"w)
  • Material: 100% polyester; soft touch
  • Hand wash cold. Do not bleach. Line dry. Do not wring.
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 140 cm x 88.26 cm (55.13" x 34.75")

About This Design

Viking Pattern Blue Throw Blanket

Viking Pattern Blue Throw Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating188 Total Reviews
142 total 5-star reviews33 total 4-star reviews6 total 3-star reviews3 total 2-star reviews4 total 1-star reviews
188 Reviews
Reviews for similar products
5 out of 5 stars rating
By J.6 September 2017Verified Purchase
Throw Blanket
Zazzle Reviewer Program
I ordered an art deco sofa pillow in the design shown. I wanted a woven throw in that design as well, but they had quit making anything but fleece throws (which I didn't want). I kept in touch with the designer (she is in England, I'm in USA) and she talked with Zazzle. When they began making woven throws again, I jumped on it and ordered this! When I received it, it was about commemorating someone's 100th birthday - not at all what I ordered. I talked with Zazzle and the designer and the problem was quickly rectified. They didn't even ask that I return the original wrong throw. This throw is beautiful, matches the pillow perfectly, and is just what I wanted. Emms Childs, the designer, was delightful to work with and Zazzle gave great customer service - very professional, prompt and kind to replace it quickly and not require me to return the incorrect one. It is crisp with the colors true to the photo. Excellent.
5 out of 5 stars rating
By Michael C.28 November 2017Verified Purchase
Throw Blanket
Zazzle Reviewer Program
Love the wall art,see pic below. Excellent article happy with purchase and price,although good tip is......WAIT FOR BLACK FRIDAY ......BARGAINS GALORE. Great wee site,bookmark it for future use. I never had printing done.
5 out of 5 stars rating
By Antique I.15 November 2021Verified Purchase
Throw Blanket
Creator Review
A beautiful small blanket that is perfect for covering your legs while curled up in front of the fire, or for a decorative touch on the sofa. We also think it looks brilliant as a Christmas table centerpiece. We are delighted with it. The colors are absolutely perfect. Vibrant yet traditional. The pattern retains its lovely details despite the texture of the fabric. Very classy product that will not disappoint as a gift.
from zazzle.com (US)

Tags

Throw Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256771172664853319
Created on 18/11/2017, 12:55
Rating: G