Tap / click on image to see more RealViewsTM
£34.75
per tie
 

Viking Pattern Blue Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139 cm (55")
    • Width: 10.16 cm (4") (at widest point)
  • Printed in vibrant full colour
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small up-charge. Check out the "Design Area" tab to the right to customise
  • Dry clean only

About This Design

Viking Pattern Blue Tie

Viking Pattern Blue Tie

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.5 out of 5 stars rating2.6K Total Reviews
1899 total 5-star reviews335 total 4-star reviews138 total 3-star reviews71 total 2-star reviews119 total 1-star reviews
2,562 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous5 August 2025Verified Purchase
Tie
Very happy with 1) quality of the print 2) quality & cut of the tie 3) speed of manufacturing 4) communication & 5) delivery to UK. I discovered the product just 2 weeks before a wedding so had to use the express delivery but it arrived within days so I could relax. My first experience of this seller & Zazzle and both were great .
5 out of 5 stars rating
By Mental M.29 March 2022Verified Purchase
Tie
Zazzle Reviewer Program
I wasn't sure what to expect but was excited to have a tie for my husband which matched my wedding attire. A super easy process taking a photo of my dress and uploading it to the website. I waited in anticipation not knowing how it would turn out. I couldn't believe the quality, its excellent. The print, pattern and colour is strong and vibrant. I have uploaded a photo but its difficult to see the tie against the dress because the quality is exceptional. I would have no hesitation using this company again.
5 out of 5 stars rating
By David P.8 January 2022Verified Purchase
Tie
Zazzle Reviewer Program
Very high quality tie,with bold colours,and high quality finish. Arrived on time,and is of excellent quality. Very clear,and bold colours

Tags

Ties
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 151059692602002001
Created on 28/07/2017, 22:06
Rating: G