Tap / click on image to see more RealViewsTM
£34.75
per tie
 

Viking Pattern Blue Tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 139 cm (55")
      • Width: 10.16 cm (4") (at widest point)
    • Printed in vibrant full colour
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small up-charge. Check out the "Design Area" tab to the right to customise
    • Dry clean only

    About This Design

    Viking Pattern Blue Tie

    Viking Pattern Blue Tie

    Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

    Customer Reviews

    4.5 out of 5 stars rating2.6K Total Reviews
    1932 total 5-star reviews337 total 4-star reviews147 total 3-star reviews78 total 2-star reviews136 total 1-star reviews
    2,630 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Anonymous5 August 2025Verified Purchase
    Tie
    Very happy with 1) quality of the print 2) quality & cut of the tie 3) speed of manufacturing 4) communication & 5) delivery to UK. I discovered the product just 2 weeks before a wedding so had to use the express delivery but it arrived within days so I could relax. My first experience of this seller & Zazzle and both were great .
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Mental M.29 March 2022Verified Purchase
    Tie
    Zazzle Reviewer Program
    I wasn't sure what to expect but was excited to have a tie for my husband which matched my wedding attire. A super easy process taking a photo of my dress and uploading it to the website. I waited in anticipation not knowing how it would turn out. I couldn't believe the quality, its excellent. The print, pattern and colour is strong and vibrant. I have uploaded a photo but its difficult to see the tie against the dress because the quality is exceptional. I would have no hesitation using this company again.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By David P.8 January 2022Verified Purchase
    Tie
    Zazzle Reviewer Program
    Very high quality tie,with bold colours,and high quality finish. Arrived on time,and is of excellent quality. Very clear,and bold colours

    Tags

    Ties
    scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
    All Products
    scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

    Other Info

    Product ID: 151059692602002001
    Created on 28/07/2017, 22:06
    Rating: G