Tap / click on image to see more RealViewsTM
£16.75
per mug
 

Viking Pattern Blue Two-Tone Coffee Mug

Qty:
Two-Tone Mug
-£1.15
+£1.10
+£4.80
+£10.35
Black

Other designs from this category

About Mugs

Sold by

Style: Two-Tone Mug

Add a pop of colour to your morning coffee! The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the inside is vividly glazed in rich colour. Give this fun gift to a friend, or add some zest to your dinnerware collection.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Viking Pattern Blue Two-Tone Coffee Mug

Viking Pattern Blue Two-Tone Coffee Mug

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating22.5K Total Reviews
19822 total 5-star reviews1895 total 4-star reviews358 total 3-star reviews150 total 2-star reviews242 total 1-star reviews
22,467 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rose S.9 June 2020Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
Great mug which I customised for myself using my photo library. I unfortunately broke the handle of my first mug. As my previous order was kept in history of orders I was able just to reorder without having to customise the mug again, & so was able to order exactly the same mug as a replacement. The customisation turned out exactly as I requested, the prints & colours crisp & clear & true to the originals
5 out of 5 stars rating
By Anonymous15 January 2026Verified Purchase
Two-Tone Mug, 444 ml
From ordering to delivery, absolutely perfect! Really nice looking solid, mug too, worth the money paid. It was a pressie for the other half and she loves it! Thanku .
5 out of 5 stars rating
By Chiara R.27 December 2017Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
I love this mug, I designed it for myself (the only thing wrong is the pink color in the print: it's darker than the preview). The inside color is perfect and also the print has a high quality finissage. colors are a bit Darker, so my pink heart and logo aren't like the preview.

Tags

Mugs
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 168824120322378292
Created on 19/12/2016, 19:15
Rating: G