Tap / click on image to see more RealViewsTM
£8.80
per set of 6 labels
 

Viking Pattern Blue Wine Label

Qty:
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
-£1.45
-£2.95
+£5.85
+£5.85
+£5.85
+£5.85
+£5.85

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm (3.5"x4"); fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Viking Pattern Blue Wine Label

Viking Pattern Blue Wine Label

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating1.9K Total Reviews
1763 total 5-star reviews85 total 4-star reviews17 total 3-star reviews9 total 2-star reviews33 total 1-star reviews
1,907 Reviews
Reviews for similar products
5 out of 5 stars rating
By Aquinas O.12 December 2023Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
The product was reasonably priced and the product came out as good as the original I drew it. The Printing came out good quality, and thick quality paper.
5 out of 5 stars rating
By Sandra S.6 April 2020Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
Beautiful labels, amazing quality. I got them for our homemade limoncello and have been getting compliments on the label ever since! They peel off and stick on easily and last very well - the bottles are being kept in a fridge and the label has not gotten wet and is lasting very well. Perfect finishing touch to my bottles. Great image and paper quality, lovely design and a very professional feel
5 out of 5 stars rating
By P.14 November 2023Verified Purchase
Wine Bottle Label 8.9 cm x 10.2 cm (3.5"x 4")
Zazzle Reviewer Program
The labels were ordered and used for memorial candles, which everyone loved. The printing of my photo and words added to the labels were excellent and printed well

Tags

Food and Beverage Label Sets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256235785226518717
Created on 18/11/2017, 11:50
Rating: G