Tap / click on image to see more RealViewsTM
£7.05
per sheet of 20
 

Vintage Damask leaf Wedding Sticker Navy Blue

Qty:
Square Stickers
+£0.30
+£0.30
+£0.30

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Vintage Damask leaf Wedding Sticker Navy Blue

Vintage Damask leaf Wedding Sticker Navy Blue

Elegant and inspiring, this design features a beautiful vintage damask leaf portrayed in Navy Blue and white for a classic look. Wedding stickers are the Perfect finishing touch for your wedding invitations, thank you notes or bridal shower favours. Matching items available in our shop @ www.celebrateitweddings.com. This item is available in a variety of colour combinations!

Customer Reviews

4.8 out of 5 stars rating4.1K Total Reviews
3550 total 5-star reviews391 total 4-star reviews93 total 3-star reviews39 total 2-star reviews59 total 1-star reviews
4,132 Reviews
Reviews for similar products
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Elaine P.15 July 2023Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend
5 out of 5 stars rating
By Carolyn S.20 May 2018Verified Purchase
Zazzle Reviewer Program
These classy stickers sit well on products they look good, the ink, quality of paper & glue enhances the durability of the product . I would recommend these. The printing is high quality, the style is vintage which is the look I was going for

Tags

Stickers
wedding stickerswedding stickervintagedamaskleafleavesnavybluemidnightwhite
All Products
wedding stickerswedding stickervintagedamaskleafleavesnavybluemidnightwhite

Other Info

Product ID: 217578051289458758
Created on 09/04/2011, 13:30
Rating: G