Tap / click on image to see more RealViewsTM
£23.70
£3.95 per sheet of tissue paper
 

Vintage French Poster Cats Girl Milk Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 35.56 cm x 50.8 cm (14" x 20")

Customise your own creative tissue paper for gift wrapping. You can add something simple like the recipients’ name, or get fancy by adding a cool design, photo, image, or artwork for a one-of-a-kind look. Add pizazz to any present!

  • Please note that this size tissue arrives folded
  • Dimensions: 35.56 cm L x 50.8 cm W (14” L x 20” W) unfolded 35.56 cm L x 25.4 cm W (14"L x 10"W) folded
  • Full colour edge-to-edge print
  • 4535g (10lb) paper is great for wrapping jewellery, small gifts and party favours
  • 8164g (18lb) paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

Vintage French Poster Cats Girl Milk Tissue Paper

Vintage French Poster Cats Girl Milk Tissue Paper

Darling French vintage Lait Pur de la Vingeanne Sterilise Art Print by Théophile Alexandre Steinlen, with Cats at the foot of a Girl drinking Milk, is on this Tissue Paper. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating3.1K Total Reviews
2779 total 5-star reviews170 total 4-star reviews51 total 3-star reviews27 total 2-star reviews48 total 1-star reviews
3,075 Reviews
Reviews for similar products
5 out of 5 stars rating
By Erica E.3 May 2024Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 25.4 cm x 35.56 cm (10" x 14")
The application of this decoupage paper was very simple , applied with PVA glue on a plywood surface. The colour stayed true to paper before application . I used cling film to apply over ply wood , no wrinkles , very pleased with the result.
5 out of 5 stars rating
By Hayley C.24 May 2020Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm (18" x 24")
Zazzle Reviewer Program
I knew this would be stunning but it's even better than I expected! Really happy with my design and chuffed I picked this one. Be prepared to wait though if you choose the slowest delivery, took 3 weeks to come, but arrived within stated timeframe. Perfect imagery, colour and print, so easy to use the offcuts for spare bits...I only planned on doing the two back panels of my tv unit but ended up doing three other gaps!
5 out of 5 stars rating
By D.29 July 2022Verified Purchase
Zazzle Reviewer Program
High quality paper, beautiful design and perfect for decoupage. High quality and bright colours.
Original product

Tags

Tissue Paper
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets
All Products
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets

Other Info

Product ID: 256007565250066876
Created on 07/09/2019, 6:08
Rating: G