Tap / click on image to see more RealViewsTM
£1.93
per postcard
 

Vintage Italy Italian Map Travel Postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-£0.18

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H (5.6"x 4.25") qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Vintage Italy Italian Map Travel Postcard

Vintage Italy Italian Map Travel Postcard

Anyone would love to receive this vintage Italia travel postcard featuring a map of Italy with flowers and bees! Your recipient will appreciate the floral and Italian architecture motif of this postcard!

Customer Reviews

4.9 out of 5 stars rating16.4K Total Reviews
14948 total 5-star reviews1056 total 4-star reviews210 total 3-star reviews78 total 2-star reviews133 total 1-star reviews
16,425 Reviews
Reviews for similar products
5 out of 5 stars rating
By Patricia J.19 May 2021Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Bought 10 Shakespeare quotes postcards and have framed them individually and placed them around the house Love them, some are funny and some are deep and meaningful! Lovely background on some, excellent printed words. A couple of plain white cards with black print - very stricking
5 out of 5 stars rating
By Ian T.27 March 2018Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
My order was probably an awkward one! I asked for a range of different fine-art prints, in postcard size. It was all freshly printed, delivered quickly and at a very reasonable price. Best quality matt finish I've seen on a fine-art print.
5 out of 5 stars rating
By Stephanie p.17 September 2022Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
These cards are great quality, I use them as enclosure cards for my business! Hey are a little pricey but you definitely get the quality and professionalism! Repurchased a few times now and will continue to do so :). Beautiful, nice sheen on them, sharp and clear

Tags

Postcards
italyvintagemaptravelitalianitaliafloralflowersbeesarchitecture
All Products
italyvintagemaptravelitalianitaliafloralflowersbeesarchitecture

Other Info

Product ID: 256641283317229366
Created on 09/10/2021, 5:01
Rating: G