Sell on Zazzle
Tap / click on image to see more RealViewsTM
£18.80
per sticker
 

Wedding individual guest names script labels

4.2 out of 5 stars rating
196 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl StickerCreate your own from scratch

Sticker Sheet Size: Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 35.6 cm L x 14.12.7 cm W
  • Design Area: 35.6 cm L x 35.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Wedding individual guest names script labels

Wedding individual guest names script labels

Simple elegant custom wedding 24 guest name labels with a chic black and white classic handwriting calligraphy script.
Celebrations and Parties JOY
Platinum
Artwork designed by
View their Store

Customer Reviews

4.2 out of 5 stars rating196 Total Reviews
142 total 5-star reviews11 total 4-star reviews10 total 3-star reviews10 total 2-star reviews23 total 1-star reviews
196 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By H.2 October 2023 • Verified Purchase
Medium 15.24 cm x 15.24cm (6" x 6") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The product was easy to order, arrived very quickly and was just what I wanted for my exhibition stand. Perfect Clear and concise , looked amazing on the whiteboard on the stand
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aurelia T.5 May 2022 • Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Stephanie E.2 April 2022 • Verified Purchase
Medium 15.24 cm x 15.24cm (6" x 6") Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Excellent quality used 3 times. Durable for traveling. Use for invitations

Tags

Custom-Cut Vinyl Stickers
guest names wedding stickersblack and whitestylishsimplescriptindividual names for place cardhandwriting calligraphy24 wedding guest names labelselegantclassic
All Products
guest names wedding stickersblack and whitestylishsimplescriptindividual names for place cardhandwriting calligraphy24 wedding guest names labelselegantclassic

Other Info

Product ID: 256818840828089474
Created on 13/05/2026, 22:55
Rating: G