Tap / click on image to see more RealViewsTM
£10.00
per sheet of 20
 

Window Cats Square Sticker

Qty:

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Window Cats Square Sticker

Window Cats Square Sticker

Meow

Customer Reviews

4.8 out of 5 stars rating27.2K Total Reviews
23581 total 5-star reviews2228 total 4-star reviews565 total 3-star reviews346 total 2-star reviews518 total 1-star reviews
27,238 Reviews
5 out of 5 stars rating
By Julie M.11 June 2016Verified Purchase
Zazzle Reviewer Program
I loved the two cats sitting in a window lit by the moonlight of a giant moon. Just beautiful! Very clear graphics. High gloss and well made.
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.

Tags

Stickers
catcatskittypetpetsanimalanimalswindowmoonsticker
All Products
catcatskittypetpetsanimalanimalswindowmoonsticker

Other Info

Product ID: 217176739510735786
Created on 12/12/2013, 14:58
Rating: G