Tap / click on image to see more RealViewsTM
£5.00
per sticker
 

Yvette Happy Birthday silver Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Small 10.16 cm x 10.16 cm (4" x 4") Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 10.16 cm (4") L x 11.43 cm (4.5") H
  • Design Area: 10.16 cm (4") L x 10.16 cm (4") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Yvette Happy Birthday silver Sticker

Yvette Happy Birthday silver Sticker

A very nice stylish personalized sticker / sticker for Yvette. The name as text and happy Birthday is available in different sizes and also in transparent. Perfect for you, your best friend, wife, sister, mother, aunt, grandma, fiancée, cousin, partner or whatever you want to surprise with a personal and individual gift. Please check our shop for more products as a gift idea with this name. Here you will find many more personalized products and designs.

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
899 total 5-star reviews65 total 4-star reviews27 total 3-star reviews22 total 2-star reviews75 total 1-star reviews
1,088 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kevin L.29 March 2021Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
These stickers look and feel fantastic. The material is in a matte finish, and is the biggest size print (Extra-Large 35.6 x 35.6 cm). I love the bright colours. I’m super happy with all the prints had come out. It gives us great confidence of the products. The colours are bright and colourful and don’t run (something I was really worried about), and the look of them feels great.
5 out of 5 stars rating
By Rebecca B.27 February 2024Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Printing was great very clear and great quality
5 out of 5 stars rating
By Rebecca B.27 February 2024Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Excellent quality and Very clear printing Love how some of the verse was separate really happy

Tags

Custom-Cut Vinyl Stickers
firstnamebirthdayhappystickerheartgiftyvette
All Products
firstnamebirthdayhappystickerheartgiftyvette

Other Info

Product ID: 256699036456673393
Created on 19/03/2021, 4:33
Rating: G