Tap / click on image to see more RealViewsTM
Sale Price £14.34.  
Original Price £2.65per sheet of tissue paper. Sale Price £2.39per sheet of tissue paper.
You save 10%

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

Qty:
  1. Size

  2. Style

Other designs from this category

About Tissue Paper

Sold by

Size: 25.4 cm x 35.56 cm (10" x 14")

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W (10” L x 14” W)
  • Full colour edge-to-edge print
  • 4535g (10lb) paper is great for wrapping jewellery, small gifts and party favours
  • 8164g (18lb) paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

Wrap your gifts with understated elegance using our BlushVine Tissue Paper. Featuring a seamless pattern of stylised leaves outlined in soft pink on a crisp white background, this design offers a clean, modern aesthetic with botanical charm. Perfect for weddings, baby showers, boutique packaging, or everyday gifting, the delicate leaf motif adds a refined touch to any presentation. Lightweight, versatile, and visually soothing—this tissue paper elevates your wrapping game with graceful simplicity.

Customer Reviews

4.8 out of 5 stars rating3.2K Total Reviews
2879 total 5-star reviews177 total 4-star reviews54 total 3-star reviews31 total 2-star reviews62 total 1-star reviews
3,203 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Erica E.3 May 2024Verified Purchase
Custom 14.8 g/m² Tissue, Size: 25.4 cm x 35.56 cm (10" x 14")
The application of this decoupage paper was very simple , applied with PVA glue on a plywood surface. The colour stayed true to paper before application . I used cling film to apply over ply wood , no wrinkles , very pleased with the result.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Adele D.24 April 2023Verified Purchase
Zazzle Reviewer Program
I used this paper to decopague an old chest of drawers. Paper was a good quality and adhered to painted surface well. Has dried really well with no shrinkage causing splits. Printing quality as good as expected
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Hayley C.24 May 2020Verified Purchase
Custom 14.8 g/m² Tissue, Size: 45.72 cm x 60.96 cm (18" x 24")
Zazzle Reviewer Program
I knew this would be stunning but it's even better than I expected! Really happy with my design and chuffed I picked this one. Be prepared to wait though if you choose the slowest delivery, took 3 weeks to come, but arrived within stated timeframe. Perfect imagery, colour and print, so easy to use the offcuts for spare bits...I only planned on doing the two back panels of my tv unit but ended up doing three other gaps!

Tags

blushvinetissuepapersoftpinkleafpatternminimalistgiftwrapbotanicaltissuedesignwhitebackgroundwrappingelegantpackagingpapernatureinspiredtissuepaperverticalleafmotifmoderngiftwrapstyledelicateleafdesign

Other Info

Product ID: 256347280109911345
Created on 13/08/2024, 3:47
Rating: G