Tap / click on image to see more RealViewsTM
£15.90
£2.65 per sheet of tissue paper
 

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 25.4 cm x 35.56 cm (10" x 14")

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W (10” L x 14” W)
  • Full colour edge-to-edge print
  • 4535g (10lb) paper is great for wrapping jewellery, small gifts and party favours
  • 8164g (18lb) paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

BlushVine-Minimalist Leaf Pattern Soft Pink White Tissue Paper

Wrap your gifts with understated elegance using our BlushVine Tissue Paper. Featuring a seamless pattern of stylised leaves outlined in soft pink on a crisp white background, this design offers a clean, modern aesthetic with botanical charm. Perfect for weddings, baby showers, boutique packaging, or everyday gifting, the delicate leaf motif adds a refined touch to any presentation. Lightweight, versatile, and visually soothing—this tissue paper elevates your wrapping game with graceful simplicity.

Customer Reviews

4.8 out of 5 stars rating3.2K Total Reviews
2860 total 5-star reviews177 total 4-star reviews55 total 3-star reviews31 total 2-star reviews61 total 1-star reviews
3,184 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Erica E.3 May 2024Verified Purchase
Custom 14.8 g/m² Tissue, Size: 25.4 cm x 35.56 cm (10" x 14")
The application of this decoupage paper was very simple , applied with PVA glue on a plywood surface. The colour stayed true to paper before application . I used cling film to apply over ply wood , no wrinkles , very pleased with the result.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Adele D.24 April 2023Verified Purchase
Zazzle Reviewer Program
I used this paper to decopague an old chest of drawers. Paper was a good quality and adhered to painted surface well. Has dried really well with no shrinkage causing splits. Printing quality as good as expected
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Erica E.1 July 2025Verified Purchase
Custom 26.6 g/m² Tissue, Size: 25.4 cm x 35.56 cm (10" x 14")
I am very pleased with the quality and clarity of this decoupage paper . Very easy application , will purchased again from this designer on Zazzle . .

Tags

Tissue Paper
blushvinetissuepapersoftpinkleafpatternminimalistgiftwrapbotanicaltissuedesignwhitebackgroundwrappingelegantpackagingpapernatureinspiredtissuepaperverticalleafmotifmoderngiftwrapstyledelicateleafdesign
All Products
blushvinetissuepapersoftpinkleafpatternminimalistgiftwrapbotanicaltissuedesignwhitebackgroundwrappingelegantpackagingpapernatureinspiredtissuepaperverticalleafmotifmoderngiftwrapstyledelicateleafdesign

Other Info

Product ID: 256347280109911345
Created on 13/08/2024, 3:47
Rating: G