Tap / click on image to see more RealViewsTM
£10.20
per keychain
 

Caduceus Key Ring

Qty:
Aluminum Circle
+£2.65
+£2.65
+£13.05
+£13.05

Other designs from this category

About Keychains

Sold by

Style: Metal Circle Keychain

Keep your keys safe and spectacular with this sturdy aluminium keyring from Zazzle. Beautifully printed on both sides, you can choose from thousands of designs, or personalise it with your own photos, text or unique designs. Label your car keys or keep a family photo of loved ones close to you at all times, these personalised keyrings are light and waterproof.

  • Dimensions:
    • Diameter: 2"
    • Depth: 0.045"
    • Weight: 0.05 oz.
  • Full-colour, full-bleed printing
  • Silver coloured metal key ring with plastic snap ring
  • Light and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 2". For best results please add 1/16" bleed

About This Design

Caduceus Key Ring

Caduceus Key Ring

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.6K Total Reviews
4331 total 5-star reviews813 total 4-star reviews225 total 3-star reviews120 total 2-star reviews108 total 1-star reviews
5,597 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lucy D.21 July 2023Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
Perfect, exactly as the picture showed it would look, fell in love as soon as I saw It. Perfect printing, would order again
5 out of 5 stars rating
By Paula N.11 July 2023Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
bought as birthday present for husband - Hawaiian theme, had to buy one for me also. exactly as advertised - perfect little gift
5 out of 5 stars rating
By Ali Y.4 February 2026Verified Purchase
Metal Circle Keychain, 2"
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)

Tags

Keychains
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146613818880137283
Created on 25/04/2010, 13:42
Rating: G