Tap / click on image to see more RealViewsTM
£1.88
per postcard
 

Caduceus Postcard

Qty:
  1. Paper Type

  2. Attribution

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalisation tool.

  • Dimensions: 14.22 cm L x 10.79 cm H (5.6"x 4.25") qualified USPS postcard size
  • High quality, full-colour, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Caduceus Postcard

Caduceus Postcard

Design that makes caduceus motif

Customer Reviews

4.9 out of 5 stars rating16.6K Total Reviews
15108 total 5-star reviews1062 total 4-star reviews220 total 3-star reviews87 total 2-star reviews159 total 1-star reviews
16,636 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Patricia J.19 May 2021Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
Bought 10 Shakespeare quotes postcards and have framed them individually and placed them around the house Love them, some are funny and some are deep and meaningful! Lovely background on some, excellent printed words. A couple of plain white cards with black print - very stricking
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ian T.27 March 2018Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
My order was probably an awkward one! I asked for a range of different fine-art prints, in postcard size. It was all freshly printed, delivered quickly and at a very reasonable price. Best quality matt finish I've seen on a fine-art print.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Stephanie p.17 September 2022Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
These cards are great quality, I use them as enclosure cards for my business! Hey are a little pricey but you definitely get the quality and professionalism! Repurchased a few times now and will continue to do so :). Beautiful, nice sheen on them, sharp and clear

Tags

Postcards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 239192120133082062
Created on 25/04/2010, 13:19
Rating: G