Tap / click on image to see more RealViewsTM
£20.80
per hat
 

Caduceus Trucker Hat

Qty:
White and Black

Other designs from this category

About Hats

Sold by

Style: Foam Trucker

Looking to cheer your team, promote your brand, or simply keep the sun out of your eyes? Our custom hats are the perfect way to meet all these needs and more. customise the front with a logo, design, or text and create an essential accessory that you will never leave behind!

  • Adjustable from 117.8 cm to 210.2 cm
  • 100% polyester foam front
  • Wide area to feature your design
  • 100% nylon mesh back keeps you cool
  • Available in 11 colour combinations
Recommended for ages 6+

About This Design

Caduceus Trucker Hat

Caduceus Trucker Hat

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.4K Total Reviews
1967 total 5-star reviews326 total 4-star reviews69 total 3-star reviews23 total 2-star reviews25 total 1-star reviews
2,410 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By C.16 December 2013Verified Purchase
Trucker Hat, White and Red
Zazzle Reviewer Program
My dad and I love the show Squidbillies, but now that I've moved out, we don't get to watch it together anymore. I figured this was the perfect gift for him on Christmas because we both think this is one of Early's funniest hats, and it has some sentimental value. Atleast, as much sentimental value as you can get with a hat that says "Booty Hunter" on it lol. It's big enough so that it will fit my dad's big ol' head, but its nice that it also has straps in the back, so he could adjust it if needed. I haven't tried to wash it yet, but I'm hoping the print lasts. Overall, I know my dad is going to love it and I can't wait to give it to him for Christmas. The quality of the image is excellent. The colors are bright and pop out, and the words are legible.
5.0 out of 5 stars rating
5 out of 5 stars rating
By P.10 June 2013Verified Purchase
Trucker Hat, White and Black
Zazzle Reviewer Program
I wear this hat every day. All my friends keep asking where I get it from. Looks really good quality and fits perfect for me. Design was very well printed and looks even better then in a picture.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Leonardo W.11 July 2020Verified Purchase
Trucker Hat, White and Black
Zazzle Reviewer Program
Soon as arrived I was happy with product Great quality An fit great. It was actually better then expected great quality good value im very happy

Tags

Hats
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 148478503511291049
Created on 26/04/2010, 7:24
Rating: G