Tap / click on image to see more RealViewsTM
£46.25
per case
 

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Qty:
Barely There
+£6.65

Other designs from this category

About Casemate Cases

Sold by

Style: Case-Mate Barely There Apple iPhone 15 Case

This form-fitting, featherlight Case-Mate custom case provides full coverage to your phone while still keeping your device ultra sleek and stylish.

  • Designed for the Apple iPhone 15
  • Slim profile and lightweight
  • Impact resistant, durable hard plastic
  • Case does not interfere with wireless charging
  • Lay-flat bezel to protect your screen from directly contacting surfaces
  • Access to all ports, controls & sensors
  • customise with your images, designs, and text
  • Glossy finish
  • Printed in the USA

About This Design

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Celestial Starry Flying Pigs Monogrammed Case-Mate iPhone Case

Embrace whimsy with this adorable design featuring pink flying pigs against a celestial, starry night sky. The playful motif creates a magical and fun look, perfect for those who love unique and imaginative accessories. The monogram element adds a personalised and stylish touch, making this design both charming and functional. Ideal for adding a touch of fantasy and humour to your everyday items.

Customer Reviews

4.7 out of 5 stars rating6.6K Total Reviews
5267 total 5-star reviews843 total 4-star reviews213 total 3-star reviews119 total 2-star reviews124 total 1-star reviews
6,566 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Laurie G.14 February 2024Verified Purchase
Case-Mate Phone Case, Apple iPhone 15, Barely There
Zazzle Reviewer Program
I order a phone case with a picture of my dog every time I get a new phone. I think the quality it great, and easy to fit on the phone and still use buttons. Everything about the design and quality is great, and I love it. The only thing I regret is that I zoomed in to the picture too much, and didn't realize it until I received the the phone case.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Donna S.12 December 2023Verified Purchase
Case-Mate Phone Case, Apple iPhone 15, Barely There
Creator Review
Very well made and it fit my iPhone perfectly! Turn out exactly how I wanted it. The colors were clear and very sharp.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By M Z.2 May 2024Verified Purchase
Case-Mate Phone Case, Apple iPhone 12, Barely There
Buying process was easy. I like the design process where I was able to alter and change design to my likening. Really great experience. Product looks and feels durable. Happy with the design and colours.

Tags

Casemate Cases
celestialstarsflying pigspiganimalwhimsicalfantasyquirkymonogramgift
All Products
celestialstarsflying pigspiganimalwhimsicalfantasyquirkymonogramgift

Other Info

Product ID: 256691017589660548
Created on 03/06/2024, 3:43
Rating: G