Tap / click on image to see more RealViewsTM
£12.10
per sheet of 20
 

Classic Round Corner Square Stickers

Qty:
Square Stickers
+£0.45
+£0.45
+£0.45

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Classic Round Corner Square Stickers

Classic Round Corner Square Stickers

Adorable Christmas Hair Style! Christmas StyleStickers™! Reward stickers for hair salon clients of all ages! THE WORLD’S FIRST REWARD STICKERS EXCLUSIVELY FOR THE HAIR INDUSTRY! Making Haircuts Fun!℠ Your salon customers of all ages will delight in collecting amusing and colourful new StyleStickers™! Fun reward stickers with entertaining cartoons and graphics with captions about getting a haircut, a shampoo, having a good hair day, and of course baby’s FIRST haircut! Encourage repeat customers and loyalty. Have the edge of offering StyleStickers to kids who sit still, or ones who need encouragement to get a haircut. Reward them for their visit and good behaviour! Even your wiggliest customer deserves StyleStickers stickers! They’ll be sure and tell everyone which hairdressers gives out stickers and what hair salons carry them! How will StyleStickers™ benefit your salon? • Increase customer loyalty and repeat business • Encourage good behaviour in your young customers • Offer the newest, most UNIQUE reward product EVER, for your salon!

Customer Reviews

4.8 out of 5 stars rating27.3K Total Reviews
23595 total 5-star reviews2229 total 4-star reviews567 total 3-star reviews347 total 2-star reviews519 total 1-star reviews
27,257 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
hairsalonstylistskidsrewardstickerschildrenschristmasprize
All Products
hairsalonstylistskidsrewardstickerschildrenschristmasprize

Other Info

Product ID: 256721556215514832
Created on 28/11/2024, 20:32
Rating: G