Tap / click on image to see more RealViewsTM
£10.50
£1.75 per coaster
 

Elegant Thanksgiving Pear Wreath Illustration Round Paper Coaster

Qty:
Round
+£0.05
+£0.05
+£0.05
+£0.05
+£0.05
+£0.05
+£0.05
+£0.05

Other designs from this category

About Paper Coasters

Sold by

Shape: Round

Don't be the nagging host sneakily slipping coasters under glasses. Add a personalised touch to your next party and make coasters fun with these fully customisable versions. Perfect for cocktail hours, wedding receptions and even kids' parties. Stock up today and never see a water ring again!

  • Round Dimensions: 10 cm (4")
  • Sold in sets of 6.
  • Available in 7 different shapes
  • Printed in full colour on one side.
  • Made with 50 pt. pulp board.
  • Sturdy, durable, and absorbent and perfect for parties, weddings or branding your business.

About This Design

Elegant Thanksgiving Pear Wreath Illustration Round Paper Coaster

Elegant Thanksgiving Pear Wreath Illustration Round Paper Coaster

Modern Thanksgiving Wreath Fall Motif Elements for Thanksgiving Gifts

Customer Reviews

4.7 out of 5 stars rating620 Total Reviews
510 total 5-star reviews79 total 4-star reviews15 total 3-star reviews8 total 2-star reviews8 total 1-star reviews
620 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jake H.24 July 2023Verified Purchase
Square Coasters
Zazzle Reviewer Program
Exactly what was wanted for a birthday dinner - dead simple but really well made, a lovely touch to add to the table. Exactly as I requested - changes and wording were done with no problem
5 out of 5 stars rating
By JULIE B.13 October 2021Verified Purchase
Ticket Coasters
Zazzle Reviewer Program
we wanted a different way to announce getting married and this was just perfect. Quality was excellent and arrived on time. printing was perfect - colours were vibrant
5 out of 5 stars rating
By J.6 January 2019Verified Purchase
Square Coasters
Zazzle Reviewer Program
Product was ordered just before Christmas on the 12th and was received in the UK in time so service was great. The print was very good, what expected to be solid mats - these were card like pub beermats but they were still well made and made a lovely present. Very good print loved it

Tags

Paper Coasters
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath
All Products
fallautumnleavesgreeneryleafthanksgivingthanksgiving giftsthankfulbranchwreath

Other Info

Product ID: 256810345067221464
Created on 01/11/2020, 6:10
Rating: G