Tap / click on image to see more RealViewsTM
Sale Price £33.84.  
Original Price £37.60 per tie
You save 10%

First Fibonacci Plaid Nerdy Math Tartan Tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 139 cm (55")
      • Width: 10.16 cm (4") (at widest point)
    • Printed in vibrant full colour
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small up-charge. Check out the "Design Area" tab to the right to customise
    • Dry clean only

    About This Design

    First Fibonacci Plaid Nerdy Math Tartan Tie

    First Fibonacci Plaid Nerdy Math Tartan Tie

    Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

    Customer Reviews

    4.5 out of 5 stars rating2.6K Total Reviews
    1932 total 5-star reviews337 total 4-star reviews147 total 3-star reviews78 total 2-star reviews136 total 1-star reviews
    2,630 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Anonymous5 August 2025Verified Purchase
    Tie
    Very happy with 1) quality of the print 2) quality & cut of the tie 3) speed of manufacturing 4) communication & 5) delivery to UK. I discovered the product just 2 weeks before a wedding so had to use the express delivery but it arrived within days so I could relax. My first experience of this seller & Zazzle and both were great .
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Mental M.29 March 2022Verified Purchase
    Tie
    Zazzle Reviewer Program
    I wasn't sure what to expect but was excited to have a tie for my husband which matched my wedding attire. A super easy process taking a photo of my dress and uploading it to the website. I waited in anticipation not knowing how it would turn out. I couldn't believe the quality, its excellent. The print, pattern and colour is strong and vibrant. I have uploaded a photo but its difficult to see the tie against the dress because the quality is exceptional. I would have no hesitation using this company again.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Stephen T.17 March 2019Verified Purchase
    Tie
    Zazzle Reviewer Program
    When I received the tie the quality of the product was good, the design was great and the feel was like silk. However, the delivery company let you down: it eventually arrived, but it was after the time that I ideally wanted the product. However, once it arrive I was happy with my purchase. The design was lighter than the picture showed it, but I was still impressed with the print.

    Tags

    fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

    Other Info

    Product ID: 151220032616911856
    Created on 20/02/2016, 12:52
    Rating: G