Tap / click on image to see more RealViewsTM
£41.05
per set of six
 

Glitch: achievement ground hogger coaster

Qty:

Other designs from this category

About Cork Coasters

Sold by

Style: Hard Plastic coasters with cork back - set of six

Decorate your home with custom coasters! Made with high-gloss plastic and a non-skid cork backing, these coasters display your photos and designs with vivid and sharp colors. Perfect for hot and cold drinks, custom coasters are a great complement to any table or surface.

  • Dimensions: 9.6 cm x 9.6 cm (3.8" x 3.8")
  • Coasters come in sets of 6
  • High gloss plastic with non-skid cork backing
  • Easy wipe-clean surface
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 8.1 cm x 8.1 cm (3.2" x 3.2"). For best results please add 0.3 cm (1/8") bleed..

About This Design

Glitch: achievement ground hogger coaster

Glitch: achievement ground hogger coaster

Glitch: achievement ground hogger This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating420 Total Reviews
379 total 5-star reviews27 total 4-star reviews7 total 3-star reviews5 total 2-star reviews2 total 1-star reviews
420 Reviews
Reviews for similar products
5 out of 5 stars rating
By Simon D.8 September 2017Verified Purchase
Hard Plastic coasters with cork back - set of six
Zazzle Reviewer Program
Good quality, handsome looking Art Deco mats. The mat was exactly as it showed on the site.
5 out of 5 stars rating
By Pauline T.8 June 2020Verified Purchase
Hard Plastic coasters with cork back - set of six
Zazzle Reviewer Program
Well made and great design. Took a long time to ship to me but was in no rush. Design as pictured. Colours as shown
5 out of 5 stars rating
By D.7 August 2020Verified Purchase
Zazzle Reviewer Program
I was very surprised by the quality of these coasters they are beautifully crafted, and the sunflower watercolour image is so sharp it really pops out at you, I really love these and will order some more as a gift. The colours are so vibrant and the glossy tops make the image really stand out, they are stunning, a lovely way to brighten up dark wood or any surface. 6 coasters is also the perfect amount.

Tags

Cork Coasters
achievementgroundhoggerglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementgroundhoggerglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 163478382058221287
Created on 22/10/2014, 9:17
Rating: G