Tap / click on image to see more RealViewsTM
£15.15
per coaster
 

Glitch Rook Mask Coaster

Qty:

Other designs from this category

About Coasters

Sold by

Style: Sandstone Drink Coaster

Mom always told you to use a coaster, so make her happy by using one from Zazzle! Made to keep your tables scratch-and-moisture-free, our sandstone coasters have a cork backing, so you can use them on any surface. They also have a matte finish and work best with vintage illustrations, black-and-white photos, and personal text messages.

  • Dimensions:
    • Diameter: 10.8 cm
    • Thickness: 0.6 cm
    • Weight: 110 g.
  • Made of sandstone with a cork pad backing
  • Not dishwasher safe
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.8 cm x 10.8 cm. For best results please add 0.3 cm (1/8") bleed.

About This Design

Glitch Rook Mask Coaster

Glitch Rook Mask Coaster

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customise. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.6 out of 5 stars rating513 Total Reviews
402 total 5-star reviews71 total 4-star reviews20 total 3-star reviews7 total 2-star reviews13 total 1-star reviews
513 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By SUE W.19 December 2017Verified Purchase
Sandstone Coaster
Zazzle Reviewer Program
Brilliant quality ,ideal personal gift to personalise with plenty of room for saying or message. It's down to you to make sure your print comes in the right place ,but easy to do
5.0 out of 5 stars rating
5 out of 5 stars rating
By B.3 November 2012Verified Purchase
Sandstone Coaster
Zazzle Reviewer Program
surprisingly good quality......not just a casual gift. sharp and appropriate
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By C.3 June 2020Verified Purchase
Sandstone Coaster
Zazzle Reviewer Program
The white marble monogram gives a perfect look to my home/ work desk. The design was so accurate as it showed in the image

Tags

Coasters
glitchglitchenrookmaskmaskswetdryvactinyspeckglitchthegame
All Products
glitchglitchenrookmaskmaskswetdryvactinyspeckglitchthegame

Other Info

Product ID: 174797104312375679
Created on 23/11/2013, 17:30
Rating: G