Tap / click on image to see more RealViewsTM
£9.45
per sheet of 20
 

Hawaii Turtles Square Sticker

Qty:
Square Stickers
+£0.35
+£0.35
+£0.35

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Hawaii Turtles Square Sticker

Hawaii Turtles Square Sticker

Aloha from Hawaii! 🌺🐢✨ Capture the essence of paradise with this stunning Hawaii Islands and Turtle sticker! Featuring a graceful sea turtle gliding through crystal-clear waters, surrounded by the beauty of the Hawaiian islands, this sticker brings the spirit of aloha wherever you go. Whether you're dreaming of a Hawaiian getaway or just love the ocean, this vibrant design is perfect for your water bottle, laptop, or surfboard. Features: Premium vinyl material Water-resistant and durable Bright and bold colours that pop Let the island vibes follow you, no matter where you are! 🌊🌴

Customer Reviews

4.8 out of 5 stars rating27.5K Total Reviews
23757 total 5-star reviews2246 total 4-star reviews580 total 3-star reviews366 total 2-star reviews556 total 1-star reviews
27,505 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
alohavibeshawaiiislandsseaturtlelovetropicalstickerislandlifehawaiianvibesoceandreamsbeachvibeshawaiistickerturtlesticker
All Products
alohavibeshawaiiislandsseaturtlelovetropicalstickerislandlifehawaiianvibesoceandreamsbeachvibeshawaiistickerturtlesticker

Other Info

Product ID: 256601603014490810
Created on 25/03/2025, 20:39
Rating: G