Tap / click on image to see more RealViewsTM
The velvet details are simulated in the artwork. No actual velvet will be used in the making of this product.
£21.60
per roll
 

Luxury 24K Poinsettia Ruby & Gold Christmas Wrapping Paper

Qty:

Other designs from this category

Shop this collection

Bryan Spencer
Merry & Bright Christmas CollectionDesigned by Bryan Spencer
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality matte paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

The velvet details are simulated in the artwork. No actual velvet will be used in the making of this product.
Luxury 24K Poinsettia Ruby & Gold Christmas Wrapping Paper

Luxury 24K Poinsettia Ruby & Gold Christmas Wrapping Paper

Turn every gift into a masterpiece with our Ruby & Gold Christmas Wrapping Paper – Luxury 24K Poinsettia Holiday Gift Wrap. This opulent design features a deep ruby velvet background enriched with 24K metallic gold poinsettias, pinecones, holly leaves, and swirling flourishes that glisten with festive radiance. The diagonal repeating pattern creates a harmonious rhythm that feels both timeless and regal — perfect for luxury gift presentations, boutique branding, and high-end holiday packaging. Every inch of this 4K design balances romantic warmth and luminous contrast, bringing a touch of grandeur to your celebrations. Ideal for those who adore rich, classic Christmas tones with a modern elegant twist. ✨ Features: 4K ultra-detailed, seamless repeating pattern Deep ruby red base with radiant 24K gold accents Opulent poinsettia and holly motif for a classic yet sophisticated look Perfect for premium gifts, boutique packaging, or luxury holiday décor Available in matte, satin, and glossy finishes Wrap your holiday moments in ruby and gold — where tradition meets timeless luxury.

Customer Reviews

4.7 out of 5 stars rating4K Total Reviews
3386 total 5-star reviews377 total 4-star reviews110 total 3-star reviews68 total 2-star reviews83 total 1-star reviews
4,024 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jan T.18 August 2025Verified Purchase
Wrapping Paper, Matte Wrapping Paper
I love this paper and it was large enough to put on the back of a glazed cabinet. It’s had lots of comments. I painted the interior to extend the image and it was very pleased with the result.
5 out of 5 stars rating
By Julia M.24 May 2017Verified Purchase
Zazzle Reviewer Program
I really liked this product, the picture is lovely and the colours are really nice. I wanted it to up-cycle a writing bureau and I was concerned that the paper may be too thin. But it wasn't and it worked fine. On the pictures I have uploaded the print looks a bit aged and not so vivid and new looking. As I wanted an aged patina but the actual print is clearer and the colours are brighter. The colour and prints are good.
Original product
5 out of 5 stars rating
By B.20 October 2017Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
Very strong quality paper used. I used it to cover a lampshade, and it looks stunning now. Vibrant and vivid. Such lovely colours.

Tags

Wrapping Paper
All Products
rubygoldbellsbowsholidayschristmasgiftwrappingpaperluxury

Other Info

Product ID: 256950554251186583
Created on 15/10/2025, 8:42
Rating: G