Tap / click on image to see more RealViewsTM
Sale Price £7.56.  
Original Price £9.45 per sheet of 20
You save 20%

Marriage coffer, 1753 square sticker

Officially Licensed
Qty:
  1. Shape

  2. Format

  3. Size

  4. Paper Type

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Marriage coffer, 1753 square sticker

Marriage coffer, 1753 square sticker

French School's Marriage coffer, 1753 (ivory, enamel, crystal & semi-precious stones) located at the St. Just Cathedral, Narbonne, France. The Marriage coffer, 1753 (ivory, enamel, crystal & semi-precious stones) was created around 1753 AD.

Customer Reviews

4.7 out of 5 stars rating4.3K Total Reviews
3622 total 5-star reviews405 total 4-star reviews104 total 3-star reviews55 total 2-star reviews79 total 1-star reviews
4,265 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Elaine P.15 July 2023Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous1 April 2026Verified Purchase
Simple yet perfect addition that finished off our wedding invites .

Tags

Stickers
frenchschool1753coffretmariagechestweddingshipscarvedlapis
All Products
frenchschool1753coffretmariagechestweddingshipscarvedlapis

Other Info

Product ID: 217838966799592472
Created on 17/08/2011, 20:17
Rating: G