Tap / click on image to see more RealViewsTM
£32.30
per window cling
 

Nudimmud Window Cling

Qty:
  1. Size: 30" x 20" (76.20cm x 50.80cm)

    Find your size.
  2. Print Process

  3. Shape

Other designs from this category

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10.16 cm x 10.16 cm (4” x 4”) to a max of 132.08 cm x 182.88 cm (52” x 72”) (or max 182.88 cm x 132.08 cm (72” x 52”) if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Opaque Design: All-over White Underbase

The art is printed on a white sheet of plastic, which enhances the dynamic appearance of colors. Please note that the white sheet is opaque and will obscure text and art when viewed from the back of the window cling.

Adhesive: Cling art faces inward

The adhesive side is on the back of the window cling. All text and art are printed on the front of the window cling and face towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window where it has been applied.

About This Design

Nudimmud Window Cling

Nudimmud Window Cling

A fluffy white bird adorned with soft pink and blue feathers, nestled among silky pink and yellow blossoms on a dreamy pastel green background.

Customer Reviews

3.6 out of 5 stars rating247 Total Reviews
138 total 5-star reviews13 total 4-star reviews12 total 3-star reviews16 total 2-star reviews68 total 1-star reviews
247 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By mmmm A.29 August 2022 • Verified Purchase
Window Cling, Size: 8.00" x 11.00", Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Back of Cling
Zazzle Reviewer Program
It was really easy to order this window cling for my business. Just uploaded my logo, picked the size etc and it turned up really promptly. Super easy to fit and it looks great! Excellent price as well! I'll definitely be back for more for my car! Perfect printing! All the colours were spot on and they really pop!
5.0 out of 5 stars rating
5 out of 5 stars rating
By R.7 December 2022 • Verified Purchase
Window Cling, Size: 20.00" x 30.00", Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling
Zazzle Reviewer Program
good quality product. good quality print
5.0 out of 5 stars rating
5 out of 5 stars rating
By In S.28 December 2024 • Verified Purchase
Window Cling, Size: 4.00" x 4.00", Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Back of Cling
Sharp detail print with bright colors. Looks good.

Tags

fluffy birdcontemporarymodernflowersvintagepastelpinkgreenyellowbohemian

Other Info

Product ID: 256852668622836818
Created on 29/04/2026, 13:59
Rating: G