Sell on Zazzle
Tap / click on image to see more RealViewsTM
£7.15
per sheet of 20
 

Stickers

4.8 out of 5 stars rating
26605 Total Reviews |
by
Qty:
Shape
Square Stickers
+£0.30
+£0.30
+£0.30
Size
Paper Type

Other designs from this category

About Stickers

Sold by
Sticker
Create your own from scratch

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Stickers

Stickers

Sticker - For Sympathy card
Fordlex
Artwork designed by
Toronto, Ontario, Canada
View their Store

Customer Reviews

4.8 out of 5 stars rating26.6K Total Reviews
23171 total 5-star reviews2204 total 4-star reviews515 total 3-star reviews285 total 2-star reviews430 total 1-star reviews
26,605 Reviews
5 out of 5 stars rating
By S.12 October 2022 • Verified Purchase
Zazzle Reviewer Program
Thick stickers, vibrant colors, excellent quality. Excellent quality, vivid colors, thick paper
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025 • Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020 • Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.

Tags

Stickers
stickersstickercardcardssympathyfuneralbereavement
All Products
stickersstickercardcardssympathyfuneralbereavement

Other Info

Product ID: 217012329361447888
Created on 07/07/2021, 11:57
Rating: G