Tap / click on image to see more RealViewsTM
£10.00
per sheet of 20
 

Trendy Pig Square Sticker

Officially Licensed
Qty:
Square Stickers
+£0.35
+£0.35
+£0.35

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Trendy Pig Square Sticker

Trendy Pig Square Sticker

This design features a cute watercolor pig wearing eyeglasses.

Customer Reviews

4.8 out of 5 stars rating27.5K Total Reviews
23735 total 5-star reviews2237 total 4-star reviews577 total 3-star reviews366 total 2-star reviews550 total 1-star reviews
27,465 Reviews
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debbie C.4 November 2022Verified Purchase
Zazzle Reviewer Program
I love these stickers! I've used them on envelopes when sending people cards, I put one on my laptop, I put one of my car, and I'm still looking for fun places to put them. It's a beautiful design and just makes me smile. It's definitely very high quality, and the colors look fantastic! Great printing job.
from zazzle.com (US)
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.

Tags

Stickers
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash
All Products
pigfarmglasseseyeglasseswatercoloranimalpigletpaint splash

Other Info

Product ID: 217348790127447226
Created on 22/04/2019, 8:26
Rating: G