Tap / click on image to see more RealViewsTM
£33.25
per flask
 

Viking Pattern Blue Hip Flask

Qty:
177 ml

Other designs from this category

About Flask

Sold by

Size: Vinyl Wrapped Flask, 177 ml

Be prepared and discreet with a custom Liquid Courage™ flask. A unique gift that's perfect for weddings, birthdays, and special occasions!

  • Dimensions: 9.5 cm (L) x 11.4 cm (W) x 2.5 cm (D); 177 ml
  • Material: Stainless steel flask with attached screw-top lid
  • Printed on high-quality vinyl that is securely wrapped
  • Durable, water and fade resistant
  • Hand wash with warm water
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 9.4 cm x 21.1 cm. For best results, please add 1.1 cm bleed.

About This Design

Viking Pattern Blue Hip Flask

Viking Pattern Blue Hip Flask

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating395 Total Reviews
339 total 5-star reviews47 total 4-star reviews5 total 3-star reviews3 total 2-star reviews1 total 1-star reviews
395 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous3 February 2022Verified Purchase
Vinyl Wrapped Flask
Zazzle Reviewer Program
Great product for the golfers in my family for Christmas - old fashioned design - funky quality product - well made. Colours crisp - image clear - font style matched the image created - thanks
5 out of 5 stars rating
By Hayley T.22 August 2023Verified Purchase
Vinyl Wrapped Flask
Zazzle Reviewer Program
Love this, very cute design and can’t wait to use on my wedding day! Really good printing, excellent design
5 out of 5 stars rating
By T.11 November 2022Verified Purchase
Vinyl Wrapped Flask
Zazzle Reviewer Program
As described the recipient loved it. Perfect as described..

Tags

Flask
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256200989444562947
Created on 18/11/2017, 12:57
Rating: G