Tap / click on image to see more RealViewsTM
£53.30
per clock
 

Viking Pattern Blue Large Clock

Qty:
27.3 cm Round Acrylic
-£6.15
-£12.10
-£12.10
-£12.10

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 20.32 cm diameter or 27.30 cm diameter (8" or 10.75")
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use
California Residents: Prop 65 Disclaimer
WarningWARNING: This product can expose you to chemicals including lead, which is known to the State of California to cause cancer and birth defects or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

About This Design

Viking Pattern Blue Large Clock

Viking Pattern Blue Large Clock

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.7K Total Reviews
3064 total 5-star reviews398 total 4-star reviews83 total 3-star reviews44 total 2-star reviews68 total 1-star reviews
3,657 Reviews
Reviews for similar products
5 out of 5 stars rating
By Tammy j.9 September 2021Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
Absolutely loved it, bought for my nan & Bamp’s Emerald anniversary and they loved it. The writing on the clock was amazing
5 out of 5 stars rating
By Karen N.10 December 2017Verified Purchase
Wall Clock, 27.3 cm Round Acrylic
Zazzle Reviewer Program
Great style, perfect colouring & good quality. I absolutely love it. Definitely recommend it for those that have the marble/grey & rose gold colour schemes. Looks classy not tacky at all. the printing was perfect.
4 out of 5 stars rating
By H.5 August 2013Verified Purchase
Wall Clock, 20.3 cm Round Acrylic
Zazzle Reviewer Program
The wall clock it's very modern and look very good in my kitchen. The quality of the product is very good. The only problem I have is that I thought the wall clock was going to be a little bigger, since I order the large clock, for me this was just a regular size clock . I can imagine if I had order the small one. but besides I'm happy. The design of the product was great and the quality.

Tags

Wall Clocks
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256435204405317048
Created on 18/11/2017, 11:36
Rating: G