Tap / click on image to see more RealViewsTM
£14.60
per tag
 

Viking Pattern Blue Luggage Tag

Qty:

Other designs from this category

About Luggage Tags

Sold by

Style: Double-sided

Stand out in a crowd at the baggage carousel with a custom luggage tag from Zazzle! Sturdy and weatherproof, this luggage tag is ready to stand-up to the travel demands of any road warrior or adventure seeker. Printed using the AcryliPrint®HD printing process, your baggage tag shows designs, text, and photos in vibrant clarity and brilliant colours. Customise it with your information and escape bag mix ups for years to come!

  • Dimensions: 5.1 cm l x 8.9 cm w (2"l x 3.5"w) (standard business card size)
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
  • Leather luggage strap included
  • Printed on both sides
This product is recommended for ages 13+.

About This Design

Viking Pattern Blue Luggage Tag

Viking Pattern Blue Luggage Tag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating4.5K Total Reviews
4102 total 5-star reviews298 total 4-star reviews80 total 3-star reviews19 total 2-star reviews30 total 1-star reviews
4,529 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.7 July 2021Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
Fast delivery and very good quality. Better that I was expecting
5 out of 5 stars rating
By Arny E.20 November 2025Verified Purchase
Acrylic Luggage Tag
I highly recommend, love it.
5 out of 5 stars rating
By Maggie B.4 May 2023Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
This was purchased as part of a 40th Birthday present for my nephew who is going to Vegas. It is made of high quality, very study and we decided only to put his name on the back of the tag, but you can add a full address if you so wish. I definitely would purchase from Zazzle again. The colours and print were excellent.

Tags

Luggage Tags
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256722126263163913
Created on 28/07/2017, 22:01
Rating: G