Tap / click on image to see more RealViewsTM
£49.20
per set of 50 napkins
 

Viking Pattern Blue Napkin

Qty:
White

Other designs from this category

About Paper Napkins

Sold by

Style: Coined Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalised paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 cm w (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Viking Pattern Blue Napkin

Viking Pattern Blue Napkin

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.1K Total Reviews
2616 total 5-star reviews243 total 4-star reviews78 total 3-star reviews58 total 2-star reviews110 total 1-star reviews
3,105 Reviews
Reviews for similar products
5 out of 5 stars rating
By richard n.5 September 2020Verified Purchase
Paper Napkins, Standard Luncheon
Zazzle Reviewer Program
Initially I was apprehensive about having these paper napkins printed with the picture my granddaughteer's fiance had sent me. I thought that, because a large part of the photo was taken up with the background, the reproduction on to paper napkins would be poor. However, when the finished product arrived I was very impressed. My granddaughter's photo clearly identified her and the napkins were of a good quaity. The naopkins were a surprise and her face, when she saw them, was, one of delight. Subsequently, they became a talking point amongst all the guests who were unable to attend. I have had no hesitation in purchasing firther merchandise form this company. The colour and clarity of the reproduction was excellent - I could not find anything about the finished product with which I was unhappy.
5 out of 5 stars rating
By M.25 September 2023Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
From start to finish the experience with your company was superb. Once serviettes had a arrived (on time) the quality and over all end product was excellent really pleased. Printing on product was clear and beautifully done.
5 out of 5 stars rating
By Debbie N.19 March 2019Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
Lovely quality, arrived on time, well packaged in a sturdy box. Just the right size for our guests to use when we cut the cakes. The printing came out very well, really pleased with it; it looks lovely, exactly as expected.

Tags

Paper Napkins
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256214417618707333
Created on 18/11/2017, 16:46
Rating: G