Tap / click on image to see more RealViewsTM
£31.20
each
 

Viking Pattern Blue Tote Bag

Qty:
  1. Style

  2. Size

Other designs from this category

About Totes

Sold by

Style: All-Over-Print Tote Bag, Medium

The classic tote with a modern twist: all-over-print allows for 100% customisation, bringing the basic tote to the next level. Your next shopping trip just got a little more earth-friendly and a lot more stylish!

  • Dimensions: 40.6 cm l x 40.6 cm w; Strap: 71.1 cm l
  • Material:
    • Exterior: 100% sturdy brushed polyester
    • Interior: 100% polyester nonwoven laminate
  • 100% cotton web handles
  • Printed then sewn for edge-to-edge designs
  • Black laminated lining for extra support
  • Spot or dry clean only
  • Made in the USA

About This Design

Viking Pattern Blue Tote Bag

Viking Pattern Blue Tote Bag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating2.3K Total Reviews
2143 total 5-star reviews120 total 4-star reviews21 total 3-star reviews7 total 2-star reviews21 total 1-star reviews
2,312 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Joanne P.8 September 2018Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Creator Review
The tote bag is smashing! It feels very sturdy and well made. A great size, can fit all your bits and pieces and the handles are strong, but long enough to be able to sling over your shoulder. Perfect for out and about! Absolutely love it! Have to say, the print is excellent! I should know, I painted the original painting. I ordered the bag to see how well my painting translated into a bag and I am wowed! Some pics of my original painting and the bag next to it, fabulous print job!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ruth B.18 June 2020Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Creator Review
I was really pleased with the high quality and size of the shopping bag. The printing was excellent, really clear and the colours were great.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ruth B.2 July 2020Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Creator Review
Really high quality product and a great size. The printing is excellent and the colours were beautiful

Tags

Totes
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256198166661462734
Created on 28/07/2017, 22:07
Rating: G