Sell on Zazzle
Tap / click on image to see more RealViewsTM
£7.05
per sheet of 20
 

Warmest Christmas Wishes Chalkboard Style Square Sticker

4.8 out of 5 stars rating
26665 Total Reviews |
by
Qty:
Shape
Square Stickers
+£0.30
+£0.30
+£0.30
Size
Paper Type

Other designs from this category

Shop this collection

Bryan Spencer
Merry & Bright Christmas CollectionDesigned by Bryan Spencer
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Stickers

Sold by
Sticker
Create your own from scratch

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Warmest Christmas Wishes Chalkboard Style Square Sticker

Warmest Christmas Wishes Chalkboard Style Square Sticker

Share the spirit of the season with our “Warmest Christmas Wishes” Holiday Sticker, featuring a charming chalkboard-style background, scalloped white border, and elegant white script typography surrounded by festive details — snowmen, candy canes, Christmas trees, and colorful gifts. Perfect for sealing envelopes, decorating gifts, or adding a cozy holiday touch to cards and packages, this high-quality sticker captures the warmth and joy of Christmas in a beautifully classic design. A delightful finishing touch for any holiday mailing, party favor, or stocking stuffer.
SpencersUnlimited
Artwork designed by
Howell, New Jersey, United States
View their Store

Customer Reviews

4.8 out of 5 stars rating26.7K Total Reviews
23210 total 5-star reviews2206 total 4-star reviews519 total 3-star reviews290 total 2-star reviews440 total 1-star reviews
26,665 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025 • Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020 • Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017 • Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
christmasstickerchristmaswisheshappyholidaysholidaystickermerrychristmaschalkboardstylepersonalizedfestiveeditable
All Products
christmasstickerchristmaswisheshappyholidaysholidaystickermerrychristmaschalkboardstylepersonalizedfestiveeditable

Other Info

Product ID: 256273258511261111
Created on 06/11/2025, 11:25
Rating: G