Tap / click on image to see more RealViewsTM
Sale Price £32.64.  
Original Price £38.40 per shirt
You save 15%

Wine Winemaker Grapevine Grape T-Shirt

Qty:
  1. Size

  2. Style

  3. Colour & Print Process: Black

    Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favourites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Wine Winemaker Grapevine Grape T-Shirt

Wine Winemaker Grapevine Grape T-Shirt

A super grapevine drawing for winemakers and wine lovers who like grapevines. A great design idea also for hobby gardeners who like to grow wine. The grapevine is a great motif for winemakers and wine connoisseurs who love their grapes.

Customer Reviews

4.7 out of 5 stars rating33.3K Total Reviews
26066 total 5-star reviews5079 total 4-star reviews1151 total 3-star reviews509 total 2-star reviews509 total 1-star reviews
33,314 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Joan B.26 April 2021 • Verified Purchase
Basic Dark T-Shirt, Black, Large
Zazzle Reviewer Program
I give wanted to give this a 4 instead of a 5 because these Basic DARK T0shirts run unexpectedly SLIM or Narrow. Which is great if you do not have a potbelly, but I have a paunch. It isn't the shirt's fault that I've got a beer belly. The design and shirt itself is a quality cotton shirt. The color is more of a deep purple, but still a very pretty color. The Basic DARK T-shirts run a bit SLIMMER than the Basic Ts. The neck is a fraction narrower (or seems to be narrower) also. I'm a paunchy middle-aged woman and my neck is 12 inches (31cm) thick and the neckline fell about the same as in the photo of the man, and I had the desire to tug it a bit. So if you're a thick necked man or like loose shirts, be aware these are slimmer shirts. Once I get rid of my lockdown paunch it'll look great. The shirt washed well in cold water with no apparent bleeding. We don't have a dryer, so it hung dry. Did not shrink. Love the colors and the design. The design looks smaller on my shirt than it does on the model on-line. But still, it looks good on the shirt. The printing looks as it does on the model, just the size seems fractionally smaller. Washed garment in cold water, hung dry and design appeared unaffected.
5.0 out of 5 stars rating
5 out of 5 stars rating
By The B.25 April 2022 • Verified Purchase
Basic Dark T-Shirt, Black, Large
Zazzle Reviewer Program
It’s a good quality cotton T Shirt, the colour is true to the description and it washes well on a cold wash. I was really pleased with printing, the detail was there and the colour was a true representation of the painting I submitted. It’s had many compliments from friends and one suggested trying it without the speech bubble as it was a bit loud for his humourless and shy personality so I’ve added one to my shop. I’ll definitely be trying more ideas so watch this space!
5.0 out of 5 stars rating
5 out of 5 stars rating
By BARBARA M.7 August 2019 • Verified Purchase
Basic Dark T-Shirt, Black, Large
Zazzle Reviewer Program
Really pleased with this Tee shirt. The quality is excellent and a good fit and comfortable. came very quickly. Recommend it , you won’t be disappointed. Colour was as expected and shown , printing is superb, it’s a must for anyone with this breed of dog.

Tags

winegrapevinewinemakerslikegreatmotifconnoisseurstheirgrapesfarmer

Other Info

Product ID: 235321457657820985
Created on 04/01/2022, 11:59
Rating: G