Tap / click on image to see more RealViewsTM
Sale Price £7.56.  
Original Price £9.45 per sheet of 20
You save 20%

Winter Snowflake Christmas sticker

Qty:

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Winter Snowflake Christmas sticker

Winter Snowflake Christmas sticker

Featuring a beautifully detailed snowflake and the classic message “Merry Christmas,” this design brings seasonal charm to gift bags, wrapped presents, envelopes, party favors, and holiday packaging. The crisp winter motif and clean typography make it perfect for both modern and traditional Christmas themes. Whether you’re personalizing family gifts, creating custom holiday treats, or adding a professional touch to handmade items, these stickers make your presents look extra special. A simple, stylish, and joyful way to share the spirit of the season! Perfect for: 🎁 Gift wrapping ❄️ Holiday party favors 📦 Small business packaging 💌 Christmas cards & envelopes Spread cheer with every gift you give!

Customer Reviews

4.8 out of 5 stars rating27.5K Total Reviews
23775 total 5-star reviews2247 total 4-star reviews585 total 3-star reviews369 total 2-star reviews560 total 1-star reviews
27,536 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sally M.6 April 2022Verified Purchase
Zazzle Reviewer Program
I was really pleased with the stickers and the design, they are exactly what I was looking for. Delivered on time and good value. Colours look great and printing good quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Natalie H.14 December 2021Verified Purchase
Zazzle Reviewer Program
I’m very happy with my stickers they are perfect for labelling my candles. Customer service and the prices have always been spot on. I would highly recommend. I love the colour and wording on my stickers
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rebecca B.27 February 2024Verified Purchase
Zazzle Reviewer Program
Such great quality stickers for my candles Perfect size, very happy with these ⭐️⭐️⭐️⭐️⭐️. Excellent printing quality and colour

Tags

Stickers
giftwrappingchristmasstickertagsnowflakemerryhoildayredsnowflakes
All Products
giftwrappingchristmasstickertagsnowflakemerryhoildayredsnowflakes

Other Info

Product ID: 256743275812021445
Created on 07/12/2025, 14:43
Rating: G