Tap / click on image to see more RealViewsTM
£9.30
£1.55 per coaster
 

First Fibonacci Plaid Square Paper Coaster

Qty:
  1. Shape

Other designs from this category

About Paper Coasters

Sold by

Shape: Square

Don't be the nagging host sneakily slipping coasters under glasses. Add a personalised touch to your next party and make coasters fun with these fully customisable versions. Perfect for cocktail hours, wedding receptions and even kids' parties. Stock up today and never see a water ring again!

  • Square Dimensions: 10 cm x 10 cm (4" x 4").
  • Sold in sets of 6.
  • Available in 7 different shapes
  • Printed in full colour on one side.
  • Made with 50 pt. pulp board.
  • Sturdy, durable, absorbent and perfect for parties, weddings or branding your business.

About This Design

First Fibonacci Plaid Square Paper Coaster

First Fibonacci Plaid Square Paper Coaster

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.7 out of 5 stars rating653 Total Reviews
536 total 5-star reviews82 total 4-star reviews16 total 3-star reviews9 total 2-star reviews10 total 1-star reviews
653 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jake H.24 July 2023Verified Purchase
Square Coasters
Zazzle Reviewer Program
Exactly what was wanted for a birthday dinner - dead simple but really well made, a lovely touch to add to the table. Exactly as I requested - changes and wording were done with no problem
4.0 out of 5 stars rating
4 out of 5 stars rating
By Anonymous25 April 2026Verified Purchase
A very difficult design to find so happy I did. Very good quality. Colours a little disappointing but still happy with my purchase.
5.0 out of 5 stars rating
5 out of 5 stars rating
By JULIE B.13 October 2021Verified Purchase
Ticket Coasters
Zazzle Reviewer Program
we wanted a different way to announce getting married and this was just perfect. Quality was excellent and arrived on time. printing was perfect - colours were vibrant

Tags

Paper Coasters
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

Other Info

Product ID: 256165514977023455
Created on 01/03/2016, 10:14
Rating: G