Tap / click on image to see more RealViewsTM
£9.30
£1.55 per coaster
 

First Fibonacci Plaid Square Paper Coaster

Qty:
Square

Other designs from this category

About Paper Coasters

Sold by

Shape: Square

Don't be the nagging host sneakily slipping coasters under glasses. Add a personalised touch to your next party and make coasters fun with these fully customisable versions. Perfect for cocktail hours, wedding receptions and even kids' parties. Stock up today and never see a water ring again!

  • Square Dimensions: 10 cm x 10 cm (4" x 4").
  • Sold in sets of 6.
  • Available in 7 different shapes
  • Printed in full colour on one side.
  • Made with 50 pt. pulp board.
  • Sturdy, durable, absorbent and perfect for parties, weddings or branding your business.

About This Design

First Fibonacci Plaid Square Paper Coaster

First Fibonacci Plaid Square Paper Coaster

Plaid for math fans. This blue and green plaid pattern was created by converting the numbers of the Fibonacci sequence into hexadecimal and using those as the hex codes for the colour then using the Fibonacci sequence to define the strand count.

Customer Reviews

4.7 out of 5 stars rating636 Total Reviews
523 total 5-star reviews80 total 4-star reviews16 total 3-star reviews9 total 2-star reviews8 total 1-star reviews
636 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jake H.24 July 2023Verified Purchase
Square Coasters
Zazzle Reviewer Program
Exactly what was wanted for a birthday dinner - dead simple but really well made, a lovely touch to add to the table. Exactly as I requested - changes and wording were done with no problem
5 out of 5 stars rating
By JULIE B.13 October 2021Verified Purchase
Ticket Coasters
Zazzle Reviewer Program
we wanted a different way to announce getting married and this was just perfect. Quality was excellent and arrived on time. printing was perfect - colours were vibrant
5 out of 5 stars rating
By J.6 January 2019Verified Purchase
Square Coasters
Zazzle Reviewer Program
Product was ordered just before Christmas on the 12th and was received in the UK in time so service was great. The print was very good, what expected to be solid mats - these were card like pub beermats but they were still well made and made a lovely present. Very good print loved it

Tags

Paper Coasters
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright
All Products
fibonaccimathpatternplaidgeekynerdsmartfuncolourfulbright

Other Info

Product ID: 256165514977023455
Created on 01/03/2016, 10:14
Rating: G